1.67 Rating by CuteStat

texasscooterrentals.com is 1 decade 2 years old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, texasscooterrentals.com is SAFE to browse.

PageSpeed Score
74
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

192.254.234.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 2
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 7
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 192.254.234.33)

E-rim | Upgrade your bike to an e-bike

- e-rim.com

Simply replace your front bicycle wheel with the E-rim. Instantly receive a 30 miles range with 16 mph top speed. Put on more miles in a breeze.

294,229 $ 30,240.00

EZ Tutorials for Beginner to Advanced - Tutsout

- tutsout.com

If you are in geo1, call us today! Tutsout

Not Applicable $ 8.95

Breakfast Sandwich Maker Recipes

- breakfastsandwichmakerrecipes.com
Not Applicable $ 8.95

Drew Martens | Creative Perceptions

- drewmartens.com
Not Applicable $ 8.95

HostGator Web Hosting Website Startup Guide

- donnabellpsychotherapy.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Server: nginx/1.6.1
Date: Sat, 09 Aug 2014 13:50:49 GMT
Content-Type: text/html
Transfer-Encoding: chunked
Connection: keep-alive
Content-Encoding: gzip

Domain Information

Domain Registrar: DropCatch.com 1435 LLC
Registration Date: May 3, 2012, 12:00 AM 1 decade 2 years 1 week ago
Last Modified: Jul 29, 2014, 12:00 AM 9 years 9 months 2 weeks ago
Expiration Date: May 3, 2015, 12:00 AM 9 years 2 weeks 15 hours ago
Domain Status:
clientTransferProhibited

Domain Nameserver Information

Host IP Address Country
ns273.hostgator.com 192.254.234.252 United States of America United States of America
ns274.hostgator.com 192.254.234.253 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
texasscooterrentals.com A 14392 IP: 192.254.234.33
texasscooterrentals.com NS 21599 Target: ns273.hostgator.com
texasscooterrentals.com NS 21599 Target: ns274.hostgator.com
texasscooterrentals.com SOA 21599 MNAME: ns6489.hostgator.com
RNAME: dnsadmin.gator3245.hostgator.com
Serial: 2014080700
Refresh: 86400
Retry: 7200
Expire: 3600000
Minimum TTL: 86400
texasscooterrentals.com MX 14399 Target: texasscooterrentals.com
texasscooterrentals.com TXT 14399 TXT: v=spf1 a mx include:websitewelcome.com
~all

Full WHOIS Lookup

Whois Server Version 2.0

Domain names in the .com and .net domains can now be registered
with many different competing registrars. Go to http://www.internic.net
for detailed information.

Domain Name: TEXASSCOOTERRENTALS.COM
Registrar: ENOM, INC.
Whois Server: whois.enom.com
Referral URL: http://www.enom.com
Name Server: NS273.HOSTGATOR.COM
Name Server: NS274.HOSTGATOR.COM
Status: clientTransferProhibited
Updated Date: 29-jul-2014
Creation Date: 03-may-2012
Expiration Date: 03-may-2015

>>> Last update of whois database: Sat, 09 Aug 2014 13:50:37 UTC